PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G120200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 263aa    MW: 28309.3 Da    PI: 10.1592
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G120200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.33.4e-3347101155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kprlrWt +LH+rFv+av+qLGG++kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Seita.6G120200.1.p  47 KPRLRWTADLHDRFVDAVSQLGGPDKATPKAIMRTMGVKGLTLFHLKSHLQKYRL 101
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-3144102IPR009057Homeodomain-like
PROSITE profilePS512949.97644104IPR017930Myb domain
TIGRFAMsTIGR015571.3E-2447102IPR006447Myb domain, plants
SuperFamilySSF466898.96E-1747102IPR009057Homeodomain-like
PfamPF002495.0E-849100IPR001005SANT/Myb domain
PfamPF143791.8E-21142187IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MFPGLIHHAG RGGRPDAAGA EDSPRGGGLG LHGHGGGPSV VLTADPKPRL RWTADLHDRF  60
VDAVSQLGGP DKATPKAIMR TMGVKGLTLF HLKSHLQKYR LGRQSGKELT EQSKDASYLM  120
EAQSGTNSSP RGSTPDVKES QELKEALRAQ MEVQRRLHEQ VEVQKHMQIR MEANQKYIDA  180
ILDKAFKIVS EQLSGISISD RDLPDLASAG VMFSPADPLS PSVFHQLSVS AVSLLSPGGG  240
KALPHVAIDI SQKPPELKRK SR*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9678390.0EU967839.1 Zea mays clone 306497 myb family transcription factor-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973254.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK51e-51APL_ARATH; Myb family transcription factor APL
TrEMBLK4JFL61e-137K4JFL6_MAIZE; G2-like transcription factor (Fragment)
TrEMBLB4FPL51e-137B4FPL5_MAIZE; Myb family transcription factor-related protein
STRINGGRMZM2G113742_P011e-136(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34273873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.19e-72G2-like family protein